Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18)

This Recombinant Human T cell receptor beta variable 18 (TVB18) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 Mouse Monoclonal Antibody [Clone ID: OTI1H9]
CF813251 100 µg

SOX2 Mouse Monoclonal Antibody [Clone ID: OTI1H9]

Sign In for Pricing
View Details
PKM2 Antibody
KC-13971-01 50 μL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
KC-13971-02 100 µL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
KC-13971-03 1 mL

PKM2 Antibody

Sign In for Pricing
View Details
E-Cadherin(CDH1) Rabbit Monoclonal Antibody [Clone ID: OTIR5C4]
TA592137 100 µL

E-Cadherin(CDH1) Rabbit Monoclonal Antibody [Clone ID: OTIR5C4]

Sign In for Pricing
View Details
CYB5R3 Human Gene Knockout Kit (CRISPR)
KN401592 1 Kit

CYB5R3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details