Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18)

This Recombinant Human T cell receptor beta variable 18 (TVB18) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nhsl2 shRNA (UAS) - Lentiviral mouse Nhsl2 shRNA (UAS, iRFP) plasmid
GTR15124828 1 Vial

Lentiviral mouse Nhsl2 shRNA (UAS) - Lentiviral mouse Nhsl2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse HSPBP1 siRNA
abx920005-01 15 nmol

Mouse HSPBP1 siRNA

Sign In for Pricing
View Details
Mouse HSPBP1 siRNA
abx920005-02 30 nmol

Mouse HSPBP1 siRNA

Sign In for Pricing
View Details
SMURF1 Recombinant Rabbit monoclonal Antibody
HA723181 100 µL

SMURF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human ZNF8 activation kit by CRISPRa
GA105201 1 Kit

Human ZNF8 activation kit by CRISPRa

Sign In for Pricing
View Details
Growth Arrest Specific Protein 7 (GAS7) (NM_201432) Human Recombinant Protein
TP300285L 1 mg

Growth Arrest Specific Protein 7 (GAS7) (NM_201432) Human Recombinant Protein

Sign In for Pricing
View Details