Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L)

This Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L) spans the amino acid sequence from region 14-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 6-like, mitochondrial UQCRHL

UniProt

A0A096LP55

Expression Region

14-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTRR Antibody, FITC conjugated
CSB-PA890659EC01HU-01 50 µg

MTRR Antibody, FITC conjugated

Sign In for Pricing
View Details
MTRR Antibody, FITC conjugated
CSB-PA890659EC01HU-02 100 µg

MTRR Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus recX Protein (aa 1-272) (strain USA300 / TCH1516)
VAng-Cr6127-50gEcoli 50 µg (E. coli)

Recombinant Staphylococcus Aureus recX Protein (aa 1-272) (strain USA300 / TCH1516)

Sign In for Pricing
View Details
Phospho-Stat2 (Tyr690) Rabbit Polyclonal Antibody (BF555)
orb2429771 100 µL

Phospho-Stat2 (Tyr690) Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ELISA Kit for Mucin 17 (MUC17)
TRV-0004995-01 24 Tests

ELISA Kit for Mucin 17 (MUC17)

Sign In for Pricing
View Details
ELISA Kit for Mucin 17 (MUC17)
TRV-0004995-02 48 Tests

ELISA Kit for Mucin 17 (MUC17)

Sign In for Pricing
View Details