Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16S V3-V4 Library Preparation Kit for Illumina (Set B)
70420 96 Preparations

16S V3-V4 Library Preparation Kit for Illumina (Set B)

Sign In for Pricing
View Details
Nfu1 (NM_020045) Mouse Tagged ORF Clone
MG201993 10 µg

Nfu1 (NM_020045) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human ANGPTL3 Recombinant Rabbit monoclonal Antibody
HA725079 100 µL

Human ANGPTL3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Calcein UltraBlue™ sodium salt
21909-AAT 1 mg

Calcein UltraBlue™ sodium salt

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF740 conjugate, 0.1mg/mL
BNC742965-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GalNacb(1,4)Galb-O-BSA Colloidal Gold Conjugate, 1mL 20nm
CCG-1016-20 1 mL

GalNacb(1,4)Galb-O-BSA Colloidal Gold Conjugate, 1mL 20nm

Sign In for Pricing
View Details