Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11)

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3A Antibody (MAP1LC3A)
F46104-0.08ML 0.08 mL

LC3A Antibody (MAP1LC3A)

Sign In for Pricing
View Details
ARH (LDLRAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A12]
TA503851AM 100 µL

ARH (LDLRAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A12]

Sign In for Pricing
View Details
Human TRIM11 activation kit by CRISPRa
GA113066 1 Kit

Human TRIM11 activation kit by CRISPRa

Sign In for Pricing
View Details
PDCD7 Polyclonal Antibody
E-AB-12835-01 20 µL

PDCD7 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD7 Polyclonal Antibody
E-AB-12835-02 60 µL

PDCD7 Polyclonal Antibody

Sign In for Pricing
View Details
PDCD7 Polyclonal Antibody
E-AB-12835-03 120 µL

PDCD7 Polyclonal Antibody

Sign In for Pricing
View Details