Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS (component B) -81/S, ARS, LY6LS, MDM) (Biotin)
133529-Biotin 100 µL

SLURP1 (Secreted Ly-6/uPAR-related Protein 1, SLURP-1, Anti-neoplastic Urinary Protein, ANUP, ARS Component B, ArsB, ARS (component B) -81/S, ARS, LY6LS, MDM) (Biotin)

Sign In for Pricing
View Details
Anti-Phospho-Raf-1 (S289) Antibody
A00446S289-1 100 µL

Anti-Phospho-Raf-1 (S289) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal HSP90 beta Antibody [DyLight 350]
NBP1-77561UV 0.1 mL

Rabbit Polyclonal HSP90 beta Antibody [DyLight 350]

Sign In for Pricing
View Details
Diacetyl Bis (2,4-dinitrophenylhydrazone)
sc-391603 1 g

Diacetyl Bis (2,4-dinitrophenylhydrazone)

Sign In for Pricing
View Details
Human CD113 Protein, His Tag
E40KMPH6364 20 µg

Human CD113 Protein, His Tag

Sign In for Pricing
View Details
Septin-9 Recombinant Protein Antigen
NBP2-55358PEP 100 µL

Septin-9 Recombinant Protein Antigen

Sign In for Pricing
View Details