Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfrsf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6880806 1.0 µg DNA

Tnfrsf4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
HIST1H2AD Protein Vector (Human) (pPM-C-His)
PV082996 500 ng

HIST1H2AD Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Wfdc16 shRNA (UAS) - Lentiviral mouse Wfdc16 shRNA (UAS, RFP) plasmid
GTR15205489 1 Vial

Lentiviral mouse Wfdc16 shRNA (UAS) - Lentiviral mouse Wfdc16 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lentiviral human PCDHB5 shRNA (UAS) - Lentiviral human PCDHB5 shRNA (UAS, GFP) (25)
GTR15316127 1 Vial

Lentiviral human PCDHB5 shRNA (UAS) - Lentiviral human PCDHB5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
C7orf66 ORF Vector (Human) (pORF)
14705011 1.0 µg DNA

C7orf66 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olr742 Protein Vector (Rat) (pPM-C-HA)
34644026 500 ng

Olr742 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details