Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1)

This Recombinant Human Probable non-functional T cell receptor gamma variable (TRGV1) spans the amino acid sequence from region 21-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable TRGV1

UniProt

A0A0A0MS02

Expression Region

21-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NLEGRTKSVTRLTGSSAEITCDLPGASTLYIHWYLHQEGKAPQCLLYYEPYYSRVVLESGITPGKYDTGSTRSNWNLRLQNLIKNDSGFYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHH Polyclonal Antibody
E912503 100 µL

SHH Polyclonal Antibody

Sign In for Pricing
View Details
SF3B4 Human shRNA Plasmid Kit (Locus ID 10262)
TL309505 1 Kit

SF3B4 Human shRNA Plasmid Kit (Locus ID 10262)

Sign In for Pricing
View Details
RNF130 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2377931 100 µL

RNF130 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Human Anti-Natalizumab antibody ELISA Kit
EH5355 96 Tests

Human Anti-Natalizumab antibody ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Vanbaalenii rsmH Protein (aa 1-324)
VAng-Yyj5352-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Vanbaalenii rsmH Protein (aa 1-324)

Sign In for Pricing
View Details
Tribromofluoromethane - stablized with Copper
FT77392-01 10 g

Tribromofluoromethane - stablized with Copper

Sign In for Pricing
View Details