Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pabpc1 Rat shRNA Plasmid (Locus ID 171350)
TR712772 1 Kit

Pabpc1 Rat shRNA Plasmid (Locus ID 171350)

Sign In for Pricing
View Details
EIF4EBP1 Conjugated Antibody
C38227 100 µL

EIF4EBP1 Conjugated Antibody

Sign In for Pricing
View Details
Adenovirus Monoclonal Antibody
VAnt-Wyb303 Each

Adenovirus Monoclonal Antibody

Sign In for Pricing
View Details
OR4T1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV737507 1.0 µg DNA

OR4T1P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Gamma-Aminobutyric Acid Receptor Subunit Beta-3 (Gabrb3) Antibody (PE)
abx444354 100 µg

Gamma-Aminobutyric Acid Receptor Subunit Beta-3 (Gabrb3) Antibody (PE)

Sign In for Pricing
View Details
Human Secreted Frizzled Related Protein 5 ELISA Kit
MBS017811-01 48 Well

Human Secreted Frizzled Related Protein 5 ELISA Kit

Sign In for Pricing
View Details