Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMZ30
441508-01 1 mg

AMZ30

Sign In for Pricing
View Details
AMZ30
441508-02 2.5 mg

AMZ30

Sign In for Pricing
View Details
Rat Mboat4 / Ghrelin O-acyltransferase Recombinant Protein
R3525r 1 Each

Rat Mboat4 / Ghrelin O-acyltransferase Recombinant Protein

Sign In for Pricing
View Details
Cyp11a1-set siRNA/shRNA/RNAi Lentivector (Rat)
17310096 4x 500 ng

Cyp11a1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
KTN1 cDNA Clone
MBS1278981-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

KTN1 cDNA Clone

Sign In for Pricing
View Details
KTN1 cDNA Clone
MBS1278981-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

KTN1 cDNA Clone

Sign In for Pricing
View Details