Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67)

This Recombinant Human Probable non-functional T cell receptor beta variable 6-7 (TVB67) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 6-7 TRBV6-7

UniProt

A0A0A0MS04

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHVLKTGQSMTLLCAQDMNHEYMYRYRQDPGKGLRLIYYSVAAALTDKGEVPNGYNVSRSNTEDFPLKLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA5 (Patatin-Like Phospholipase Domain-Containing Protein 5, Patatin-Like Phospholipase Domain Containing 5)
488926 100 µL

PNPLA5 (Patatin-Like Phospholipase Domain-Containing Protein 5, Patatin-Like Phospholipase Domain Containing 5)

Sign In for Pricing
View Details
Recombinant Human Rab9 effector protein with kelch motifs (C-His)
BP2799-500ug 500 µg

Recombinant Human Rab9 effector protein with kelch motifs (C-His)

Sign In for Pricing
View Details
WM-67-99-OR-PK Adhesive-backed Marker Combination Packs
112269 825 Pack (33 Label (s) x 25 Card)

WM-67-99-OR-PK Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details
MAGEB3 Mouse Monoclonal Antibody [Clone ID: OTI7E2]
TA808841 100 µL

MAGEB3 Mouse Monoclonal Antibody [Clone ID: OTI7E2]

Sign In for Pricing
View Details
Inhibitor hsa-miR-4661-5p AAV miRNA Vector
Amh3159200 500 ng

Inhibitor hsa-miR-4661-5p AAV miRNA Vector

Sign In for Pricing
View Details
(e,e)-2,4-Heptadienyldiphenylphosphine Oxide
MBS6079575-01 100 mg

(e,e)-2,4-Heptadienyldiphenylphosphine Oxide

Sign In for Pricing
View Details