Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23)

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholesterol Acyltransferase 1 (Sterol O-acyltransferase 1, Acyl-coenzyme A:cholesterol Acyltransferase 1, ACAT-1, SOAT1, ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT) (Biotin)
MBS6269475-01 0.1 mL

Cholesterol Acyltransferase 1 (Sterol O-acyltransferase 1, Acyl-coenzyme A:cholesterol Acyltransferase 1, ACAT-1, SOAT1, ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT) (Biotin)

Sign In for Pricing
View Details
Cholesterol Acyltransferase 1 (Sterol O-acyltransferase 1, Acyl-coenzyme A:cholesterol Acyltransferase 1, ACAT-1, SOAT1, ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT) (Biotin)
MBS6269475-02 5x 0.1 mL

Cholesterol Acyltransferase 1 (Sterol O-acyltransferase 1, Acyl-coenzyme A:cholesterol Acyltransferase 1, ACAT-1, SOAT1, ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT) (Biotin)

Sign In for Pricing
View Details
KIF25 Rabbit Polyclonal Antibody (HRP)
orb2135757 100 µL

KIF25 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NCR3 cDNA Clone
MBS1267886-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

NCR3 cDNA Clone

Sign In for Pricing
View Details
NCR3 cDNA Clone
MBS1267886-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

NCR3 cDNA Clone

Sign In for Pricing
View Details
Rabbit Polyclonal NEK10 Antibody [DyLight 350]
NBP2-99009UV 0.1 mL

Rabbit Polyclonal NEK10 Antibody [DyLight 350]

Sign In for Pricing
View Details