Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145)

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGR1 (GPR68) Human Gene Knockout Kit (CRISPR)
KN212925RB 1 Kit

OGR1 (GPR68) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Scopoline
TRC-S201428-50MG 50 mg

Scopoline

Sign In for Pricing
View Details
Bisphenol AP-d5
TRC-B519488-1MG 1 mg

Bisphenol AP-d5

Sign In for Pricing
View Details
Tuberin (TSC2) pSer1420 Rabbit Polyclonal Antibody
AP12895PU-N 400 µL

Tuberin (TSC2) pSer1420 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), Biotin conjugate, 0.1mg/mL
BNCB2266-100 1x 100 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene A RAM
HA140023.100G 100 g

Polystyrene A RAM

Sign In for Pricing
View Details