Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349)

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQUB (m) -PR
sc-146280-PR 10 µM - 20 µL

IQUB (m) -PR

Sign In for Pricing
View Details
Dinotefuran
E0176-100mg 100 mg

Dinotefuran

Sign In for Pricing
View Details
HIP55 Polyclonal Antibody, APC Conjugated
bs-20165R-APC 100 µL

HIP55 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLight 650)
133324-ML650 100 µL

SHIP2 (Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2, SH2 Domain-containing Inositol-5'-phosphatase 2, SH2 Domain-containing Inositol Phosphatase 2, SHIP-2, Inositol Polyphosphate Phosphatase-like Protein 1, INPPL-1, Protein 51C, INPPL1) (MaxLight 650)

Sign In for Pricing
View Details
2-Amino-7-cyclopropyl[1,2,4]triazolo[1,5-a]pyrimidine
OR14278 1 Each

2-Amino-7-cyclopropyl[1,2,4]triazolo[1,5-a]pyrimidine

Sign In for Pricing
View Details
Chicken proteinkinase B (PKB) ELISA Kit
EIA06234Ch 1 Kit

Chicken proteinkinase B (PKB) ELISA Kit

Sign In for Pricing
View Details