Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF9B (NM_001007537) Human Over-expression Lysate
LY423504 100 µg

C1QTNF9B (NM_001007537) Human Over-expression Lysate

Sign In for Pricing
View Details
CARD12 (NLRC4) Rabbit Polyclonal Antibody
TA369017 100 µL

CARD12 (NLRC4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561903 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Loxoprofen Sodium (Mixture of diastereomers)
TRC-L472900-5G 5 g

Loxoprofen Sodium (Mixture of diastereomers)

Sign In for Pricing
View Details
Trip4 Mouse Gene Knockout Kit (CRISPR)
KN518252 1 Kit

Trip4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ChmL Mouse Gene Knockout Kit (CRISPR)
KN503274 1 Kit

ChmL Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details