Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21)

This Recombinant Human Immunoglobulin kappa variable 6D-21 (KVD21) spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 6D-21 IGKV6D-21

UniProt

A0A0A0MT36

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPDFQSVTPKEKVTITCRASQSIGSSLHWYQQKPDQSPKLLIKYASQSISGVPSRFSGSGSGTDFTLTINSLEAEDAAAYYCHQSSSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 Immunizing Peptide
orb738315 100 µg

SOX2 Immunizing Peptide

Sign In for Pricing
View Details
TNFAIP8 Recombinant Rabbit mAb
BS46307-01 50 µL

TNFAIP8 Recombinant Rabbit mAb

Sign In for Pricing
View Details
TNFAIP8 Recombinant Rabbit mAb
BS46307-02 100 µL

TNFAIP8 Recombinant Rabbit mAb

Sign In for Pricing
View Details
FLAP (ALOX5AP) (NM_001629) Human Tagged ORF Clone Lentiviral Particle
RC203785L2V 200 µL

FLAP (ALOX5AP) (NM_001629) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gmps sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3103308 1.0 µg DNA

Gmps sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Procambarus clarkii Orcokinin peptides type A
MBS7101445-01 0.05 mg (E-Coli)

Recombinant Procambarus clarkii Orcokinin peptides type A

Sign In for Pricing
View Details