Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66)

This Recombinant Human T cell receptor beta variable 6-6 (TVB66) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zkscan16 Mouse Gene Knockout Kit (CRISPR)
KN520092 1 Kit

Zkscan16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CPMTS
#91011 1x 5 mg

CPMTS

Sign In for Pricing
View Details
Ferritin Conjugated Pisum sativum Lectin (Garden Pea) -PEAPSA-
I-2701-1 1 mg

Ferritin Conjugated Pisum sativum Lectin (Garden Pea) -PEAPSA-

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS708201 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
4-Guanidinobenzoic Acid-D4 Hydrochloride
TRC-G821302-25MG 25 mg

4-Guanidinobenzoic Acid-D4 Hydrochloride

Sign In for Pricing
View Details
CD62L (SELL) Mouse Monoclonal Antibody [Clone ID: B-S13]
AM31191PU-N 2 mL (200 Tests)

CD62L (SELL) Mouse Monoclonal Antibody [Clone ID: B-S13]

Sign In for Pricing
View Details