Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66)

This Recombinant Human T cell receptor beta variable 6-6 (TVB66) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F13530P-01 25 µg

Purified Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
Purified Anti-Mouse CD4 Antibody[RM4-5]
E-AB-F13530P-02 100 µg

Purified Anti-Mouse CD4 Antibody[RM4-5]

Sign In for Pricing
View Details
TPOR (MPL) Rabbit Polyclonal Antibody
TA384794 100 µL

TPOR (MPL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEP1B Polyclonal Antibody
E-AB-65731-01 60 µL

MEP1B Polyclonal Antibody

Sign In for Pricing
View Details
MEP1B Polyclonal Antibody
E-AB-65731-02 120 µL

MEP1B Polyclonal Antibody

Sign In for Pricing
View Details
MEP1B Polyclonal Antibody
E-AB-65731-03 200 µL

MEP1B Polyclonal Antibody

Sign In for Pricing
View Details