Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-8 (TVB68)

This Recombinant Human T cell receptor beta variable 6-8 (TVB68) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-8 TRBV6-8

UniProt

A0A0A6YYG3

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYMSWYRQDPGMGLRLIYYSAAAGTTDKEVPNGYNVSRLNTEDFPLRLVSAAPSQTSVYLCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Epiregulin Antibody (MM0265- 12Y4) [CoraFluor 1]
NBP2-12285CL1 0.1 mL

Mouse Monoclonal Epiregulin Antibody (MM0265- 12Y4) [CoraFluor 1]

Sign In for Pricing
View Details
Sept11 3'UTR Lenti-reporter-Luc Vector
52018086 1.0 µg

Sept11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793) (MaxLight 490)
137921-ML490 100 µL

Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793) (MaxLight 490)

Sign In for Pricing
View Details
CD96 Antibody
OACA09988-50UG 50 µg

CD96 Antibody

Sign In for Pricing
View Details
PTCD3 Protein Vector (Mouse) (pPB-N-His)
PV220591 500 ng

PTCD3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CNDP1 Protein Vector (Human) (pPM-C-His)
PV050884 500 ng

CNDP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details