Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kynurenine (11F9) Alexa Fluor® 790
sc-69890 AF790 200 µg/mL

Kynurenine (11F9) Alexa Fluor® 790

Sign In for Pricing
View Details
PLV3-CMV-3xFLAG-BCL11A (human) -CopGFP-Puro
BZ55046 1 Vial

PLV3-CMV-3xFLAG-BCL11A (human) -CopGFP-Puro

Sign In for Pricing
View Details
ERC1 (NM_178039) Human Tagged Lenti ORF Clone
RC214948L3 10 µg

ERC1 (NM_178039) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse RNF5 Protein, His (Fc)-Avi-tagged
RNF5-7688M 50 µg

Recombinant Mouse RNF5 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Anti-OSBPL10 Antibody Picoband®, Cy3 Conjugate
A07484-2-Cy3 100 µg/Vial

Anti-OSBPL10 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Rabbit Anti-HOXD12 antibody
SL17370R-01 50 µL

Rabbit Anti-HOXD12 antibody

Sign In for Pricing
View Details