Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19)

This Recombinant Human T cell receptor alpha variable 19 (TVA19) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPRM1, phosphorylated (S375) (MOR1, OPRM1, Mu-type opioid receptor, M-OR-1, MOR-1, Mu opiate receptor, Mu opioid receptor, MOP, hMOP)
328962-01 50 µg

OPRM1, phosphorylated (S375) (MOR1, OPRM1, Mu-type opioid receptor, M-OR-1, MOR-1, Mu opiate receptor, Mu opioid receptor, MOP, hMOP)

Sign In for Pricing
View Details
OPRM1, phosphorylated (S375) (MOR1, OPRM1, Mu-type opioid receptor, M-OR-1, MOR-1, Mu opiate receptor, Mu opioid receptor, MOP, hMOP)
328962-02 100 µg

OPRM1, phosphorylated (S375) (MOR1, OPRM1, Mu-type opioid receptor, M-OR-1, MOR-1, Mu opiate receptor, Mu opioid receptor, MOP, hMOP)

Sign In for Pricing
View Details
AIM2 ELISA Kit (Human)
OKCD08905-96W 96 Well

AIM2 ELISA Kit (Human)

Sign In for Pricing
View Details
2- (4-Fluorophenyl) imidazo[1,2-a]pyridine-3-carbaldehyde
PC410149 1 Each

2- (4-Fluorophenyl) imidazo[1,2-a]pyridine-3-carbaldehyde

Sign In for Pricing
View Details
Mouse Monoclonal GSTO2 Antibody (OTI2A12) [DyLight 755]
NBP2-72371IR 0.1 mL

Mouse Monoclonal GSTO2 Antibody (OTI2A12) [DyLight 755]

Sign In for Pricing
View Details
Zfp319 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
50916116 3x 1.0 µg

Zfp319 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details