Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136)

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SPH4 Polyclonal Antibody
MBS7170310 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) SPH4 Polyclonal Antibody

Sign In for Pricing
View Details
Nifurpipone
MBS5783211 Inquire

Nifurpipone

Sign In for Pricing
View Details
Rat Osmr ELISA Kit
ELI-05714r 96 Tests

Rat Osmr ELISA Kit

Sign In for Pricing
View Details
Aflatoxin B1 aldehyde reductase member 2
AP80737 1 mg

Aflatoxin B1 aldehyde reductase member 2

Sign In for Pricing
View Details
SPAC22E12.01 Antibody
orb856720 2 mg

SPAC22E12.01 Antibody

Sign In for Pricing
View Details
Sn-Glycerol-3-phosphate (cyclohexyl ammonium salt hydrate)
C8679-100 100 mg

Sn-Glycerol-3-phosphate (cyclohexyl ammonium salt hydrate)

Sign In for Pricing
View Details