Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5)

This Recombinant Human T cell receptor gamma variable 5 (TRGV5) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HPx1 Antibody (HIC0-3B3) [Alexa Fluor 700]
NBP1-18951AF700 0.1 mL

Mouse Monoclonal HPx1 Antibody (HIC0-3B3) [Alexa Fluor 700]

Sign In for Pricing
View Details
PSMD2 Antibody
orb1336027 100 µg

PSMD2 Antibody

Sign In for Pricing
View Details
RPL17P34 AAV siRNA Pooled Vector
40898161 1.0 µg

RPL17P34 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit
MBS9335989-01 48 Well

Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit

Sign In for Pricing
View Details
Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit
MBS9335989-02 96 Well

Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit

Sign In for Pricing
View Details
Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit
MBS9335989-03 5x 96 Well

Human Melanoma-associated antigen B4, MAGEB4 ELISA Kit

Sign In for Pricing
View Details