Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5)

This Recombinant Human T cell receptor gamma variable 5 (TRGV5) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prostaglandin E-major Urinary Metabolite ELISA kit
GTR10472303 96 Well

Human Prostaglandin E-major Urinary Metabolite ELISA kit

Sign In for Pricing
View Details
CTSH Protein Vector (Rat) (pPM-C-HA)
PV262332 500 ng

CTSH Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
2-[4- (Difluoromethyl) -6- (1,5-dimethyl-1H-pyrazol-4-yl) -3-methyl-1H-pyrazolo[3,4-b]pyridin-1-yl]acetic acid
GQB47798-01 50 mg

2-[4- (Difluoromethyl) -6- (1,5-dimethyl-1H-pyrazol-4-yl) -3-methyl-1H-pyrazolo[3,4-b]pyridin-1-yl]acetic acid

Sign In for Pricing
View Details
2-[4- (Difluoromethyl) -6- (1,5-dimethyl-1H-pyrazol-4-yl) -3-methyl-1H-pyrazolo[3,4-b]pyridin-1-yl]acetic acid
GQB47798-02 0.5 g

2-[4- (Difluoromethyl) -6- (1,5-dimethyl-1H-pyrazol-4-yl) -3-methyl-1H-pyrazolo[3,4-b]pyridin-1-yl]acetic acid

Sign In for Pricing
View Details
AATOM™ 590 acid
70240-AAT 5 mg

AATOM™ 590 acid

Sign In for Pricing
View Details
OPA1-AS1 AAV Vector (Human) (CMV)
34830101 1 µg

OPA1-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details