Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601)

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601) spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF488A conjugate, 0.1mg/mL
BNC882878-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cd5 Mouse Monoclonal Antibody [Clone ID: CG16]
CL006BX 300 µg

Cd5 Mouse Monoclonal Antibody [Clone ID: CG16]

Sign In for Pricing
View Details
IMP4 (NM_033416) Human Recombinant Protein
TP304015 20 µg

IMP4 (NM_033416) Human Recombinant Protein

Sign In for Pricing
View Details
GBA3 (C-term) Rabbit Polyclonal Antibody
AP51789PU-N 400 µL

GBA3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POU3F2 (NM_005604) Human Recombinant Protein
TP305330 20 µg

POU3F2 (NM_005604) Human Recombinant Protein

Sign In for Pricing
View Details
MDM2 (SMP14), CF594 conjugate, 0.1mg/mL
BNC941721-500 1x 500 µL

MDM2 (SMP14), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details