Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601)

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601) spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF12A CRISPRa sgRNA lentivector (set of three targets)(Human)
47203121 3x 1.0µg DNA

TNFRSF12A CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
BTK-IN-10
MBS5805396 Inquire

BTK-IN-10

Sign In for Pricing
View Details
Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody
CAU29055-01 100 µL

Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody

Sign In for Pricing
View Details
Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody
CAU29055-02 200 µL

Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody

Sign In for Pricing
View Details
Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody
CAU29055-03 1 mL

Pigment Epithelium Derived Factor (PEDF) Polyclonal Antibody

Sign In for Pricing
View Details
RGD1564114 3'UTR Luciferase Stable Cell Line
TU218887 1.0 mL

RGD1564114 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details