Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostaglandin D Synthase (PTGDS) (NM_000954) Human Over-expression Lysate
LC400343 20 µg

Prostaglandin D Synthase (PTGDS) (NM_000954) Human Over-expression Lysate

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP06341PU-N 100 µg

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit
RDR-FcgRI-Hu-01 96 Tests

Human Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit

Sign In for Pricing
View Details
Human Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit
RDR-FcgRI-Hu-02 48 Tests

Human Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit

Sign In for Pricing
View Details
Cyclophilin F (PPIF) Rabbit Monoclonal Antibody [Clone ID: R02-6I9]
TA385023 100 µL

Cyclophilin F (PPIF) Rabbit Monoclonal Antibody [Clone ID: R02-6I9]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD31 Antibody[390]
E-AB-F1180H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details