Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315)

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(2,2,2-Trifluoroethoxy)prop-1-yne
TRC-T212131-25MG 25 mg

3-(2,2,2-Trifluoroethoxy)prop-1-yne

Sign In for Pricing
View Details
Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein
TP308888M 100 µg

Apolipoprotein CI (APOC1) (NM_001645) Human Recombinant Protein

Sign In for Pricing
View Details
Etofibrate
TRC-E933150-50MG 50 mg

Etofibrate

Sign In for Pricing
View Details
Cezanne (OTUD7B) Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF809517 100 µg

Cezanne (OTUD7B) Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details
Sebox (NM_008759) Mouse Tagged ORF Clone
MG201809 10 µg

Sebox (NM_008759) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anxa4 Mouse Gene Knockout Kit (CRISPR)
KN501336 1 Kit

Anxa4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details