Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321)

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD115-8 sgRNA CRISPR Lentivector set (Human)
K2242201 3x 1.0 µg

SNORD115-8 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rat Monoclonal anti-Mouse GM-CSF Antibody
xAP-0727 100 µg

Rat Monoclonal anti-Mouse GM-CSF Antibody

Sign In for Pricing
View Details
Recombinant Shewanella piezotolerans Electron transport complex protein RnfE (rnfE)
orb2912070-01 20 µg

Recombinant Shewanella piezotolerans Electron transport complex protein RnfE (rnfE)

Sign In for Pricing
View Details
Recombinant Shewanella piezotolerans Electron transport complex protein RnfE (rnfE)
orb2912070-02 100 µg

Recombinant Shewanella piezotolerans Electron transport complex protein RnfE (rnfE)

Sign In for Pricing
View Details
ADAR1 (ADAR) (NM_001025107) Human Tagged Lenti ORF Clone
RC219761L2 10 µg

ADAR1 (ADAR) (NM_001025107) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal ATRIP Antibody (OTI5E7) [Alexa Fluor 647]
NBP2-72271AF647 0.1 mL

Mouse Monoclonal ATRIP Antibody (OTI5E7) [Alexa Fluor 647]

Sign In for Pricing
View Details