Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-21 (HV321)

This Recombinant Human Immunoglobulin heavy variable 3-21 (HV321) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-21 IGHV3-21

UniProt

A0A0B4J1V1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP7A1 Antibody
CSB-PA646965-01 50 μL

CYP7A1 Antibody

Sign In for Pricing
View Details
CYP7A1 Antibody
CSB-PA646965-02 100 µL

CYP7A1 Antibody

Sign In for Pricing
View Details
OGG1 ORF Vector (Human) (pORF)
32485011 1.0 µg DNA

OGG1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
pCMV-KLHL35-3×FLAG-SV40-Neo Plasmid
PVT46057 2 µg

pCMV-KLHL35-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
Ppil3 CRISPR Activation Plasmid (m)
sc-427643-ACT 20 µg

Ppil3 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Lentiviral human SP140 shRNA (UAS) - Lentiviral human SP140 shRNA (UAS, iRFP) (100)
GTR15127347 1 Vial

Lentiviral human SP140 shRNA (UAS) - Lentiviral human SP140 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details