Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373)

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT1 (NM_001114617) Human Over-expression Lysate
LC426494 20 µg

MGAT1 (NM_001114617) Human Over-expression Lysate

Sign In for Pricing
View Details
Arhgef38 Mouse Gene Knockout Kit (CRISPR)
KN501539 1 Kit

Arhgef38 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MyoD1 (5.8A + MYD712), CF740 conjugate, 0.1mg/mL
BNC740713-500 1x 500 µL

MyoD1 (5.8A + MYD712), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin V, CF®488A Conjugate, Azide-Free, Lyophilized
#29005R-5ug 1x 5 µg

Annexin V, CF®488A Conjugate, Azide-Free, Lyophilized

Sign In for Pricing
View Details
ZNF641 (NM_001172682) Human Over-expression Lysate
LY433036 100 µg

ZNF641 (NM_001172682) Human Over-expression Lysate

Sign In for Pricing
View Details
TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone ID: OTI1H10]
CF808547 100 µg

TFIIB (GTF2B) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

Sign In for Pricing
View Details