Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373)

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FPR-S1 siRNA
abx917185-01 15 nmol

Mouse FPR-S1 siRNA

Sign In for Pricing
View Details
Mouse FPR-S1 siRNA
abx917185-02 30 nmol

Mouse FPR-S1 siRNA

Sign In for Pricing
View Details
ZFP62 CRISPR Activation Plasmid (m)
sc-423796-ACT 20 µg

ZFP62 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PE-Cy7 anti-human/mouse/rat CD278 (ICOS)
E16FRN278-025U 25 µg

PE-Cy7 anti-human/mouse/rat CD278 (ICOS)

Sign In for Pricing
View Details
Actin (ACTA1) (NM_001100) Human Untagged Clone
SC125333 10 µg

Actin (ACTA1) (NM_001100) Human Untagged Clone

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)
MBS6219686-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (MaxLight 550)

Sign In for Pricing
View Details