Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC685045 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV643165 1.0 µg DNA

LOC685045 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Salmonella arizonae ATP synthase subunit c (atpE)
MBS1139197 Inquire

Recombinant Salmonella arizonae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
ZFP30 Antibody
MBS9416372-01 0.1 mL

ZFP30 Antibody

Sign In for Pricing
View Details
ZFP30 Antibody
MBS9416372-02 5x 0.1 mL

ZFP30 Antibody

Sign In for Pricing
View Details
MYH3 (F1.652) Alexa Fluor® 647
sc-53091 AF647 200 µg/mL

MYH3 (F1.652) Alexa Fluor® 647

Sign In for Pricing
View Details
Human LOC100996842 Knockout HEK293T cell line
GTR15418134 1 Vial

Human LOC100996842 Knockout HEK293T cell line

Sign In for Pricing
View Details