Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement Component 1, Q Subcomponent B (C1qB) ELISA Kit
orb781374-01 48 Tests

Rat Complement Component 1, Q Subcomponent B (C1qB) ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 1, Q Subcomponent B (C1qB) ELISA Kit
orb781374-02 96 Tests

Rat Complement Component 1, Q Subcomponent B (C1qB) ELISA Kit

Sign In for Pricing
View Details
Selonsertib
GW7307-1mg 1 mg

Selonsertib

Sign In for Pricing
View Details
Recombinant human 14 kDa phosphohistidine phosphatase
OPCA01287-100UG 100 µg

Recombinant human 14 kDa phosphohistidine phosphatase

Sign In for Pricing
View Details
Serum amyloid A2 Rabbit pAb, BF700 conjugated
orb2891370 100 µL

Serum amyloid A2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
SFRS3, ID (SRSF3, SFRS3, SRP20, Serine/arginine-rich splicing factor 3, Pre-mRNA-splicing factor SRP20, Splicing factor, arginine/serine-rich 3)
041633 200 µL

SFRS3, ID (SRSF3, SFRS3, SRP20, Serine/arginine-rich splicing factor 3, Pre-mRNA-splicing factor SRP20, Splicing factor, arginine/serine-rich 3)

Sign In for Pricing
View Details