Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781)

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB8A Goat Polyclonal Antibody
TA303328 100 µg

RAB8A Goat Polyclonal Antibody

Sign In for Pricing
View Details
RPE65 Rabbit pAb, FITC conjugated
orb2892671 100 µL

RPE65 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details
Repetin discontinued
345652-01 100 µL

Repetin discontinued

Sign In for Pricing
View Details
Repetin discontinued
345652-02 200 µL

Repetin discontinued

Sign In for Pricing
View Details
Abrocitinib Impurity 3
RM-A021503-01 10 mg

Abrocitinib Impurity 3

Sign In for Pricing
View Details
Abrocitinib Impurity 3
RM-A021503-02 100 mg

Abrocitinib Impurity 3

Sign In for Pricing
View Details