Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-74 (HV374)

This Recombinant Human Immunoglobulin heavy variable 3-74 (HV374) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-74 IGHV3-74

UniProt

A0A0B4J1X5

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS48 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37864151 3x 1.0 µg DNA

PRSS48 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Phospho-Eph receptor B1 (Tyr928) Rabbit pAb, IRDye 800CW conjugated
orb2877931 100 µL

Phospho-Eph receptor B1 (Tyr928) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
3- (3-Bromo-phenyl) -1-phenyl-1H-pyrazole-4-carbaldehyde
sc-345539 1 g

3- (3-Bromo-phenyl) -1-phenyl-1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
Zbtb26 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6114603 1.0 µg DNA

Zbtb26 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GENLISA™ Monkey Transthyretin (TTR) ELISA
KLW0262 1x 96 Well

GENLISA™ Monkey Transthyretin (TTR) ELISA

Sign In for Pricing
View Details
Rabbit Anti-ARF5 Polyclonal Antibody
PAV447 100 μL

Rabbit Anti-ARF5 Polyclonal Antibody

Sign In for Pricing
View Details