Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-74 (HV374)

This Recombinant Human Immunoglobulin heavy variable 3-74 (HV374) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-74 IGHV3-74

UniProt

A0A0B4J1X5

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS621544 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Rat ON (Osteonectin) QuickTest ELISA Kit
MBS7618550-01 48 Well

Rat ON (Osteonectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ON (Osteonectin) QuickTest ELISA Kit
MBS7618550-02 96 Well

Rat ON (Osteonectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ON (Osteonectin) QuickTest ELISA Kit
MBS7618550-03 5x 96 Well

Rat ON (Osteonectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ON (Osteonectin) QuickTest ELISA Kit
MBS7618550-04 10x 96 Well

Rat ON (Osteonectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Anti-VPAC2/VIPR2 Antibody Picoband®, Dylight550 Conjugate
A03768-1-Dylight550 100 µg

Anti-VPAC2/VIPR2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details