Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343)

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS, RFP) (25)
GTR15252419 1 Vial

Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla)
I7661-39K 100 µg

Integrin, beta1 (CD29, Very Late Antigen, VLAb1, Platelet gplla)

Sign In for Pricing
View Details
GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 550)
127396-ML550 100 µL

GMEB1 (Glucocorticoid Modulatory Element-binding Protein 1, GMEB-1, DNA-binding Protein p96PIF, Parvovirus Initiation Factor p96, PIF p96) (MaxLight 550)

Sign In for Pricing
View Details
Mouse anti Human IgG4 antibody
10-I129A 1 mg

Mouse anti Human IgG4 antibody

Sign In for Pricing
View Details
RPS10P12 ORF Vector (Human) (pORF)
42016011 1.0 µg DNA

RPS10P12 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olfr1170 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4285806 1.0 µg DNA

Olfr1170 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details