Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949)

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEF1 Antibody / Lymphoid enhancer-binding factor 1 / TCF alpha
V5056-100UG 100 µg

LEF1 Antibody / Lymphoid enhancer-binding factor 1 / TCF alpha

Sign In for Pricing
View Details
TLE3 (NM_020908) Human Tagged Lenti ORF Clone
RC226146L3 10 µg

TLE3 (NM_020908) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LRRC18 (D-2) Alexa Fluor® 680
sc-393659 AF680 200 µg/mL

LRRC18 (D-2) Alexa Fluor® 680

Sign In for Pricing
View Details
Rabbit Polyclonal KLF17 Antibody [mFluor Violet 610 SE]
NBP2-82001MFV610 0.1 mL

Rabbit Polyclonal KLF17 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TAF8 sgRNA CRISPR Lentivector (Human) (Target 2)
K2328903 1.0 µg DNA

TAF8 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Pcdha5 3'UTR Lenti-reporter-Luc Vector
36131086 1.0 µg

Pcdha5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details