Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2A42 (NM_001001802) Human Over-expression Lysate
LY424247 100 µg

OR2A42 (NM_001001802) Human Over-expression Lysate

Sign In for Pricing
View Details
CHAT (HRP) discontinued
558460-01 50 µg

CHAT (HRP) discontinued

Sign In for Pricing
View Details
CHAT (HRP) discontinued
558460-02 100 µg

CHAT (HRP) discontinued

Sign In for Pricing
View Details
4- (3-Fluorophenyl) oxan-4-amine hydrochloride
PC403141 1 Each

4- (3-Fluorophenyl) oxan-4-amine hydrochloride

Sign In for Pricing
View Details
DM-BINAP
sc-227946 100 mg

DM-BINAP

Sign In for Pricing
View Details
Rat ornithine carbamoyl transferase, OCT ELISA Kit
CSB-E13629r-01 24 Well

Rat ornithine carbamoyl transferase, OCT ELISA Kit

Sign In for Pricing
View Details