Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (HRP)
MBS6398396-01 0.1 mL

VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (HRP)

Sign In for Pricing
View Details
VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (HRP)
MBS6398396-02 5x 0.1 mL

VRK2 (Vaccinia-related Kinase 2, Serine/threonine-protein Kinase VRK2) (HRP)

Sign In for Pricing
View Details
RPMC Recombinant Protein (Escherichia coli)
OPCA00783-100UG 100 µg

RPMC Recombinant Protein (Escherichia coli)

Sign In for Pricing
View Details
Mouse Brain Genomic DNA
mg-201 0.1 mg

Mouse Brain Genomic DNA

Sign In for Pricing
View Details
HSPA14 Protein Vector (Human) (pPM-C-HA)
23997022 500 ng

HSPA14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Malic Acid Assay Kit
abx092307 96 Tests

Malic Acid Assay Kit

Sign In for Pricing
View Details