Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43)

This Recombinant Human Immunoglobulin kappa variable 1D-43 (KVD43) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-43 IGKV1D-43

UniProt

A0A0B4J1Z2

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPFSLSASVGDRVTITCWASQGISSYLAWYQQKPAKAPKLFIYYASSLQSGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQYYSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 750)
MBS6348724-01 0.1 mL

SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 750)

Sign In for Pricing
View Details
SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 750)
MBS6348724-02 5x 0.1 mL

SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 750)

Sign In for Pricing
View Details
SNAI1 AAV Vector (Mouse) (CMV)
44493104 1 µg

SNAI1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Slc30a2 Rat shRNA Plasmid (Locus ID 25362)
TR704027 1 Kit

Slc30a2 Rat shRNA Plasmid (Locus ID 25362)

Sign In for Pricing
View Details
SERBP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43419151 3x 1.0 µg DNA

SERBP1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GLE1 antibody
70R-2303 50 ug

GLE1 antibody

Sign In for Pricing
View Details