Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2)

This Recombinant Human T cell receptor alpha variable 2 (TVA2) spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3 (Interleukin-3, IL-3) (MaxLight 490)
MBS6264088-01 0.1 mL

IL3 (Interleukin-3, IL-3) (MaxLight 490)

Sign In for Pricing
View Details
IL3 (Interleukin-3, IL-3) (MaxLight 490)
MBS6264088-02 5x 0.1 mL

IL3 (Interleukin-3, IL-3) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-EIF4B (Ser406) Rabbit Polyclonal Antibody (BF488)
orb2513470 100 µL

Phospho-EIF4B (Ser406) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
SµLt5a1 Mouse shRNA Plasmid (Locus ID 57429)
TR503312 1 Kit

SµLt5a1 Mouse shRNA Plasmid (Locus ID 57429)

Sign In for Pricing
View Details
Recombinant IAV H16N3 Hemagglutinin / HA Protein (aa 1-529) [His] (HEK293 Cells)
VAng-Wyb6936-100g 100 µg

Recombinant IAV H16N3 Hemagglutinin / HA Protein (aa 1-529) [His] (HEK293 Cells)

Sign In for Pricing
View Details
Il13ra2 Mouse Gene Knockout Kit (CRISPR)
KN508230 1 Kit

Il13ra2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details