Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium Iodate
TRC-P698040-50G 50 g

Potassium Iodate

Sign In for Pricing
View Details
GJA1 pSer367 Rabbit Polyclonal Antibody
AP20856PU-N 100 µg

GJA1 pSer367 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fenhexamid
TRC-F247650-50MG 50 mg

Fenhexamid

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS627256 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
Dichloroacetic anhydride
TRC-D189760-1G 1 g

Dichloroacetic anhydride

Sign In for Pricing
View Details
(11Beta,16Alpha)-11-Hydroxy-16-(1-oxobutoxy)-androsta-1,4-diene-3,17-dione
TRC-H825715-10MG 10 mg

(11Beta,16Alpha)-11-Hydroxy-16-(1-oxobutoxy)-androsta-1,4-diene-3,17-dione

Sign In for Pricing
View Details