Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2)

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Slc22a8 ELISA Kit
ELI-41282r 96 Tests

Rat Slc22a8 ELISA Kit

Sign In for Pricing
View Details
Infrared Thermometer (TFI 54)
THE1830 1 Each

Infrared Thermometer (TFI 54)

Sign In for Pricing
View Details
Menaquinone 4 (Vitamin K2 (20), MK 4)
M2876-01 25 mg

Menaquinone 4 (Vitamin K2 (20), MK 4)

Sign In for Pricing
View Details
Menaquinone 4 (Vitamin K2 (20), MK 4)
M2876-02 50 mg

Menaquinone 4 (Vitamin K2 (20), MK 4)

Sign In for Pricing
View Details
Menaquinone 4 (Vitamin K2 (20), MK 4)
M2876-03 100 mg

Menaquinone 4 (Vitamin K2 (20), MK 4)

Sign In for Pricing
View Details
Menaquinone 4 (Vitamin K2 (20), MK 4)
M2876-04 250 mg

Menaquinone 4 (Vitamin K2 (20), MK 4)

Sign In for Pricing
View Details