Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10)

This Recombinant Human T cell receptor alpha variable 10 (TVA10) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dolichos biflorus Lectin (DBA) - DyLight 488
21500017-1 1 mg

Dolichos biflorus Lectin (DBA) - DyLight 488

Sign In for Pricing
View Details
SPRR3 siRNA (Human)
CRH4576-01 15 nmol

SPRR3 siRNA (Human)

Sign In for Pricing
View Details
SPRR3 siRNA (Human)
CRH4576-02 30 nmol

SPRR3 siRNA (Human)

Sign In for Pricing
View Details
Conjugated RSK1 (Phospho-S380) Rabbit mAb
C13378 100 µL

Conjugated RSK1 (Phospho-S380) Rabbit mAb

Sign In for Pricing
View Details
BST2 293 Cell Lysate
401259 0.1 mg

BST2 293 Cell Lysate

Sign In for Pricing
View Details
Recombinant Human MT-CO2 Protein, N-His
MBS1576597-01 0.1 mg

Recombinant Human MT-CO2 Protein, N-His

Sign In for Pricing
View Details