Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DNAJB8
P6215-01 50 µg

Recombinant Human DNAJB8

Sign In for Pricing
View Details
Recombinant Human DNAJB8
P6215-02 200 µg

Recombinant Human DNAJB8

Sign In for Pricing
View Details
Recombinant Human DNAJB8
P6215-03 1 mg

Recombinant Human DNAJB8

Sign In for Pricing
View Details
ATP6V1C1 (NM_001695) Human Tagged ORF Clone
RC203149 10 µg

ATP6V1C1 (NM_001695) Human Tagged ORF Clone

Sign In for Pricing
View Details
SP100 Rabbit Polyclonal Antibody
TA359191 100 µL

SP100 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TLR1 Antibody Blocking peptide
orb1455381 500 µg

TLR1 Antibody Blocking peptide

Sign In for Pricing
View Details