Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-1 (TVAM1)

This Recombinant Human T cell receptor alpha variable 13-1 (TVAM1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-1 TRAV13-1

UniProt

A0A0B4J241

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKGPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM48 CRISPR Activation Plasmid (h2)
sc-409322-ACT-2 20 µg

TRIM48 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Palmitoleic Acid sodium
orb2282962-01 100 mg

Palmitoleic Acid sodium

Sign In for Pricing
View Details
Palmitoleic Acid sodium
orb2282962-02 500 mg

Palmitoleic Acid sodium

Sign In for Pricing
View Details
Palmitoleic Acid sodium
orb2282962-03 1 g

Palmitoleic Acid sodium

Sign In for Pricing
View Details
Palmitoleic Acid sodium
orb2282962-04 5 g

Palmitoleic Acid sodium

Sign In for Pricing
View Details
CCG215022
S6621-1mg 1 mg

CCG215022

Sign In for Pricing
View Details