Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3)

This Recombinant Human T cell receptor alpha variable 3 (TVA3) spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sumo2 3'UTR GFP Stable Cell Line
TU271407 1.0 mL

Sumo2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
COX6B1P7 3'UTR Luciferase Stable Cell Line
TU004891 1.0 mL

COX6B1P7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-FMO3 Rabbit Monoclonal Antibody
MBS1756854-01 0.03 mL

Anti-FMO3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FMO3 Rabbit Monoclonal Antibody
MBS1756854-02 0.1 mL

Anti-FMO3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-FMO3 Rabbit Monoclonal Antibody
MBS1756854-03 5x 0.1 mL

Anti-FMO3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HCAIX-IN-18
orb2566137-01 25 mg

HCAIX-IN-18

Sign In for Pricing
View Details