Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1)

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zkscan4 Mouse Gene Knockout Kit (CRISPR)
KN520096 1 Kit

Zkscan4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF647 conjugate, 0.1mg/mL
BNC471748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF568 conjugate, 0.1mg/mL
BNC680680-100 1x 100 µL

Cyclin B1 (V92.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPIL6 (NM_001286361) Human Tagged ORF Clone
RG236510 10 µg

PPIL6 (NM_001286361) Human Tagged ORF Clone

Sign In for Pricing
View Details
LINGO1 Rabbit Polyclonal Antibody
TA378059 100 µL

LINGO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GP39 Antibody Pair Set
E-KAB-0419 50 µL & 100 µg

Human GP39 Antibody Pair Set

Sign In for Pricing
View Details